May
02.05 13-20.30o'clock, Rüdiger
datamining and investigation about DNA und FOKI. Paper Miller07, Wah1998.
3d analysis and pictures taken from pymol.
Alignment of 2BamHI and 2FOKI to get DNA in proper position. However it is still not perfekt,
but gives a reasonable insight into distances we need for the linker and where we can position the oligo
Figure 1: this is the truncated catalytically active fokI(dimer) bound to DNA. Pink residues are the catalytic ones. |
![]() Figure 2: Like this could be the completed construct. You see the FOKIdomains as in fig.1 combined with 2streptavidin proteins that bind to biotin. |
Scheme 3: cut through from the side to make dna accessibility visible. If we add a linker from below(in this picture it is the top) the indicated base would be a good place. |
Scheme 4: cut through from below to make dna accessibility visible. If we add a linker from below the indicated base would be a good place. |
05th may, 11-13o'clock Rüdiger
Sponsoringmeeting with Timo, Anika, Rüdigerto lazy to translate already taken notes....
Uni-interne zeitschriften zuspammen
-nachwuchsförderung
-lernen in der praxis
-kooperatives lernen
-gruppenmanagement
firmenzeitschriften finden und zuspammen
Sponsoren tour
fernsehen??!
radio
Mentorenprogramm
to do:
argumentenliste (schleimig)
-ziele
-selbstständig arbeiten
-eigenes projekt von planung bis zur vollendung, sowas gibt es sonst nirgends. Einblick in zukunft unseres
Forscherlebens.
neues universelles werkzeug für synthetische biologen: soll laboralltag revolutionieren.
2Projekte:
Entwicklung eines universellen Schneidewerkzeuges: Man könnte es mit einem Schraubenzieher vergleichen,
auf den man alle arten von Bits aufsetzen kann. Jede Art von Schraube ist mit einem einzigen ,statt,
wie bisher mit hunderten verschiedenen Schraubenziehern herausdrehbar.
Es soll neue opensource Software für iGEM entwickelt werden, das die komplete Arbeit mit den BiobrickTM
Standard Parts in einer einzigen Anwendung zusammenführt. Dies beinhaltet das Suchen und runterladen der
Sequenzen, sowie die Zusammenstellung und Bearbeitung, bis hin zur Veröffentlichung der Sequenzen in Form eines
neuen Biobrick Parts.
Man kann sich das wie Lego basteln vorstellen: Beispielsweise man möchte ein Haus aus Lego bauen.
Dazu sucht man sich alle benötigten Steine zusammen. Aber bevor man anfängt wild drauf los zu basteln,
zieht man das Programm zu Rate und spielt alle Varianten am Computer vorher durch. Das Programm zeigt einem
dabei mittels verständlicher Grafiken, was machbar und sinnvoll ist und druckt am Ende eine fertige Bauanleitung aus.
Und da das Programm der Open-source Idee verpflichtet ist, kommen alle Anleitung für alle zur freien
Verfügung ins WWW.
-programm
05th may, 17o'clock Rüdiger
17o'clock, Meeting the Captain(Igloi) with Dieter and Rüdiger. Captain tells us about how to link PNA with Protein via Ni/Co and His tag. same could be applied to link ologo and protein. dna needs to hybridize with around 30 bases oligo to properly build up double helix.07th may, 14-18o'clock Rüdiger
Dicussing FokI Sequence and further strategy with Laura, Gerrit Dieter and Kristian.Companys to buy Genes from:
-Geneart
-Mr.gene(low budget version without support)
-itelichon or sth like that
-DNA 2.0 (expensive but can demand adequate features of vector)
Glenn research Bioscience offers modified nucleotides for our oligos
Vektor we should create/order now:
*must not contain IGEM restriction sites
*1FokI, active cleavage sitewe need to check literature about that.
Possible experiment with original cys containg fokI:
add iodoacetamide to it and look if it gets acetylated and if it still cleaves.
*1FokI without cleavage Aminoacids
*replacing cys by ser (first
Possible Tags (will be investigated later in more detail):
*Fluoreszin & Digoxigenin ? coupled to oligo
*Lipocalin can bind to these specufically
*does the Captain have Ni/Co for Oligo synthesis?
*or maybe Bannwarth ? ?
Program for Vector handling: Gentle
08th may, 17.15-18.30o'clock Caro
Dicussing RAG1/RAG2 DNA cleavage mechanism with Caro, Manu, Gerrit, Hannes, Kristian, Cristoph.Question discussed:
* Which kind and how many domains have RAG1/2?
* What are the cleavage mechanims and the interaction of theese domains?
*What is the essential part of theese proteins and what can be eliminated?
Next meeting for RAG1/RAG2 and Recommbineering group: Monday, 11.may, 17.30 at kristians lab
08th may, 13:30-19:30o'clock Laura
Planning the design for two vectors including one different FokI-heterodimer each with Rüdiger, Dieter and LauraProcedures for both vectors:
*extract coding region of Fok from the restriction-modification genes of the chromosomal DNA of Flavobacterium okeanokoites [http://www.ncbi.nlm.nih.gov/nuccore/148723?ordinalpos=1&itool=EntrezSystem2.PEntrez.Sequence.Sequence_ResultsPanel.Sequence_RVDocSum F.okeanokoites fokIR and fokIM genes]
*delete the first 1158 nucleotides/386 aa (recognition domain)
*switch Cystein 541/463-465 to Ser (TGT->TCT)
Modifications of the single vectors to introduce heterodimeric modifications according to [[Media:Miller_J,_Rebar_E_Nature_biotech_2007_25_778.pdf]]:
Modifications of the first vector (catalytic active heterodimer)
-heterodimeric aminio acids *switch Glutamate 490/310-312 to Lysin (GAA->AAA)
*switch isoleucin 538/454-456 to Lysin (ATC->AAA)
Modifications of the second vector (catalytic inactive heterodimer)
-heterodimeric amino acids *switch Glutamin 486/298-300 to Glutamate (CAA->GAA)
*switch Isoleucin 499/337-339 to Leucin (ATC->CTG)
-catalytic amino acids *switch Aspartate 450/190-192 to Alanin (GAC->GCG)
*switch Aspartate 467/243-245 to Alanin (GAT->GCG)
Annotations: *The notation e.g. for Cystein 541/463-465 means the amino acid 541 in literature which correspond to the codons 463-465 in our vector.
*For exchanging the amino acids we used the Codon usage table in E.coli from Hénaut and Danchin. [http://www.faculty.ucr.edu/~mmaduro/codonusage/codontable.htm E.coli Codon Usage]
Next meeting: Monday, 11th may, 16pm at kristians lab
11th may, 17.30-19.30o'clock Max
Attendees: Hannes, Caro, Manuel, Gerrit, Christoph, MaxRAG: * Discussion about different domains. **If in RAG1 R855 and K856 are exchanged there is no hairpin but still nicking.
* RAG1: - cleavage active sites: D600,D708,E962 provides metalbinding function and ion -induced hydroxy-cleavage.
*RAG2: -The core is characterised by a six repeats of a kelch motif(50 residues each)
- each repead forms a four-stranded twisted antiparallel beta-sheet(six bladed propeller). This structure takes part in protein protein binding.
- T490 phosphorylation site
- aa 352-410 acidic portion
-aa 420-480 is a Cys-His rich reagion similar to homodomains of zink fingers
-R73A, K118A/K119A Hairpin-opening
- RAG2 binds RAG1 and DNA
* What can be taken away from the protein so that it still works? Large parts can be deleted without loosing recombination activity. The full length of mouse RAG1 is 1040 amino acids. Aminoacids 384-1008 are required. Mouse RAG2 has about 527 aa. Only the first 383(387)are required. In presence of Mn2+ RAG1/2 efficiently cuts an RSS(recombination signal sequence) in a DNA fragment to yield blunt 5´ phosphorylated signal ends and hairpin coding ends that retain the full coding sequence. * RAG may be quite difficult to be made suitable for our purpose. * We decided to look for another suiting enzyme just in case RAG turns out as not realizable.
Next meeting: Thursday, 05/14/09, 12.30 @ Zoo-Café
11th may, 16:00-20:30o'clock Laura
Planning the design for two vectors with Rüdiger, Dieter and LauraExecution of the planned modifications with the program Gentle
To avoid restriction sites of the restriction enzymes used by iGEM:
*switch Isoleucin 109-111 to Isoleucin (ATT->ATC)
*switch Alanine 520-522 to Alanine (GCC->GCG)
sequences of the completely edited active FOKI heterodimer:
-amino acid sequence: KSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVKENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLTRLNHKTNSNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF
-nucleotide sequence: AAAAGTGAACTGGAGGAGAAGAAATCTGAACTTCGTCATAAATTGAAATATGTGCCTCATGAATATATTGAATTAATTGAAATTGCCAGAAATTCCACTCAGGATAGAATCCTTGAAATGAAGGTAATGGAATTTTTTATGAAAGTTTATGGATATAGAGGTAAACATTTGGGTGGATCAAGGAAACCGGACGGAGCAATTTATACTGTCGGATCTCCTATTGATTACGGTGTGATCGTGGATACTAAAGCTTATAGCGGAGGTTATAATCTGCCAATTGGCCAAGCAGATGAAATGCAACGATATGTCAAAGAAAATCAAACACGAAACAAACATATCAACCCTAATGAATGGTGGAAAGTCTATCCATCTTCTGTAACGGAATTTAAGTTTTTATTTGTGAGTGGTCACTTTAAAGGAAACTACAAAGCTCAGCTTACACGATTAAATCATAAAACTAATTCTAATGGAGCTGTTCTTAGTGTAGAAGAGCTTTTAATTGGTGGAGAAATGATTAAAGCGGGCACATTAACCTTAGAGGAAGTGAGACGGAAATTTAATAACGGCGAGATAAACTTT
sequences ot the completely edited inactive FOKI heterodimer: -amino acid sequence:
KSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVKENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLTRLNHKTNSNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF
-nucleotide sequence: AAAAGTGAACTGGAGGAGAAGAAATCTGAACTTCGTCATAAATTGAAATATGTGCCTCATGAATATATTGAATTAATTGAAATTGCCAGAAATTCCACTCAGGATAGAATCCTTGAAATGAAGGTAATGGAATTTTTTATGAAAGTTTATGGATATAGAGGTAAACATTTGGGTGGATCAAGGAAACCGGCGGGAGCAATTTATACTGTCGGATCTCCTATTGATTACGGTGTGATCGTGGCGACTAAAGCTTATAGCGGAGGTTATAATCTGCCAATTGGCCAAGCAGATGAAATGGAACGATATGTCGAAGAAAATCAAACACGAAACAAACATCTGAACCCTAATGAATGGTGGAAAGTCTATCCATCTTCTGTAACGGAATTTAAGTTTTTATTTGTGAGTGGTCACTTTAAAGGAAACTACAAAGCTCAGCTTACACGATTAAATCATATCACTAATTCTAATGGAGCTGTTCTTAGTGTAGAAGAGCTTTTAATTGGTGGAGAAATGATTAAAGCGGGCACATTAACCTTAGAGGAAGTGAGACGGAAATTTAATAACGGCGAGATAAACTTT
Introduction of prefix and suffix according to the Fusion Protein (Freiburg)Biobrick assembly standard
[[Image:Fusion part.JPG|none|thumb|400x400px]]
Ask for an offer for our two vectors from "Biomatik Corporation"
14th May 12:30-15:00 o'clock, Hannes
Attendees: Hannes, Caro, GerritRAG
- preparation of RAG-presentation for the meeting on friday
- discussion of new ideas (AloI)
15th may 2009, 13:00- 16:00 o'clock Anika
Attendees: Max, Sascha, Timo, Hannes, Dieter, Rüdiger, Laura, Julia, Caro, Paul, Gerrit, Manuel, Kristian, AnikaPresentation of different subprojects
- FOKI
genes are ordered, each vector costs approx. 344 USD, we ordered two vectors for the beginning
- homepage
basis is written in html so that everybody can contribute to complete the page, everything in english, except the 'Vereinssatzung'in german
authors of the subitems:
Team: Caro
Project: Rüdiger
Publicity: Manu
iGEM Contest: Anika, Timo
iGEM e.V.: Laura
-> send everything to Sascha
- software
still looking for ideas, Java seems to be a good idea, program should run without an internt connnection, a Plug-In based, we will need some biologist testing this program
- sponsoring/marketing
discussion about different possibilities to find donators
- RAG1+2
group presented their plans, for the moment it seems that FOKI has the better prospect
next meeting: Wednesday, 20th May 2009
20th may 2009, 11:00 o'clock ct. Anika
Attendees: Imi, Laura, Caro, Christoph, Rüdiger, Sascha, Kristian, AnikaTopics:
1. Vereinsbelangen
Problem: If we are going to be an 'allgemeinnütziger Verein' it is prohibited to make advertising for our sponsors. On our website as well as on our T- shirts.
Caro and Laura will go to the tax and legal advice of the u-Asta.
2. Sponsoring
We are going to start posting the letters to the companies beginning of next week. There will be an extra meeting for the sponsoring group which is not arranged yet.
3. Plasmidconstruction
The ordered things arrivedwhich means that the laboratory work can start. The FokI group is looking for people who have time to work in the lab for cloning.
One more thing: the website is going to put online on Sunday this week.
25th may 2009, 10:00- 17:00 o'clock Laura and Caro
Attendees: Max, Sascha, Hannes, Gerrit, Anika, Christoph, Imi, Sonja, Caro, LauraIntroduction into the lab work:
Hier die Einführung auf deutsch (muss ja nicht ins richtige Wiki übernommen werden):
Unser Laborraum:
*UV-Gerät auf Kühlschrank zum Reinigen der Pipetten bei Handhabung mit elektrokompetenten Zellen
* fertig gegossene SDS-Gele in Kühlschrank hinter unserer bench (evtl. selber gießen)
* Kopierkarte auf Annas Platz hinter unserem Laborplatz
*Zellkulturschrank (neben Zellkultur): Zellkulturflaschen zum Sterilfiltrieren (für Puffer etc.) und große Kolben
Messraum (EKTA-Raum?): Viva spins (Zentrifugeneinsätze bei Proteinaufzentrifugation) im oberen Schrank; Spitzen (verschiedene Größen) im unteren Schrank
PCR/Gelraum (von der Tür zw. PRC-Raum und unserem Labor gesehen):
* Ethidiumbromidverschmutzter Bereich auf der bench
* Ethidiumbromid und normaler Abfall auf der bench getrennt; auch beim Ausgang an der zweiten Tür größere Abfalltonnen für EthBr (Achtung: keine Handschuhe!) und Glasbruchabfall
* Proteinpuffer und Comassiefärbelösungen in Regal über Tonnen
* eigenes Fach im -80°C Kühlschrank oben; Fach für Klone und Proteine im unteren Teil 3. Spalte, 1. Zeile
* Waage hinten rechts in der Ecke
* nichtexplosive und nichtgiftige Chemikalien im Schrank auf der rechten Seite
* brennbare und explosive Substanzen im gelben Schrank an hinterer Wand
* häufig benutzte Chemikalien im Regal rechts daneben
* im Abzug bestimmte Abfälle wie für Silber etc.
* gefährliche Chemikalien in Metallschränken unter dem Abzug
* für pH-Einstellungen pH-Meter unter Abzug (in Liste daneben mit Datum, Name und Kalibrierwert eintragen; Elektrode wird in 3M KCl-Lösung gelagert)
* Zentrifugen in der Mitte des Raumes; Zentrifugengefäße im Schrank darunter
* Laufpuffer für Gele im Schrank oberhalb der bench
Verschiedene Gänge von Kristians Labor aus gesehen:
Links:
* Kopierraum
Geradeaus:
* noch links vor Laboreingang: 37°C Raum (großen Schüttler immer wieder anstellen!)
*Platten zum Inkubieren ins Regal; Blotting-Papier und Schneidemaschine vor 37°C Raum
* im Labor: im Zentrifugenraum Eismaschine und große Zentrifugen; UV-Lichtraum zum Geldokumentieren und -schneiden weiter hinten, UV-Lichtkamera rechts von Raum nicht benutzen
Rechts:
*Schrank rechts mit Handschuhen, Eppis, Pipettenspitze (bei Gebrauch auf Liste bei Müller AG Strich)
* Geräteraum links mit temperierbaren Shakern (Alternative zu 37°C Raum; bei Gebrauch mit post-it über Dauer der Benutzung informieren)
* Biorad-Geldock auch zum Gel fotografieren (aber EthBr frei)
Spülküche (noch links vor Laboreingang):
* alle mögliche Glaswaren (Messbecher, Glaskolben etc)
* beim Platten Gießen Flasche mit Wasserbad beschriften; Flasche wird dann ins Wasserbad gestellt und kann nach zwei Stunden abgeholt werden
*Gießraum: UV-Licht vorm Betreten ausschalten!; Petrischalen vorhanden; an der Tür verbrauchte Materialien in die Liste eintragen; nach Verlassen UV-Licht wieder anschalten
*Spezialbecken für Restagar neben Waschbecken im hinteren Bereich (mit Heißwasser auspülen und wegschütten)
* daneben Feinwaagen
* Wagen für Spitzen, Eppis etc. und Wagen für Flüssigkeitsabfall zum Totautoklavieren
* Millipore Wasser-Anlage im mittleren Bereich: Process, ca. 1 min warten bis über mind. 18,1 MOhm, mit oberem Drehschalter Wasser einlassen
Goßes Labor:
* SDS-Gel Scanner; oberhalb befinden sich multipler SDS Plattengießer (mighty small), Spritzfilter und Tris-Puffer
*Eppis, Spitzen, PCR tubes und DNA Präparations Kits etc. in großem Schrank vor Waschbecken; Falcons obendrauf
* Rührfische nebenWaschbecken, Zylinder unter Waschbecken
*neben Waschbecken auch Gefäßsammelstelle für Gefäße und Flüssigkeitsabfall (falls zu voll oder Gefäße zu groß, selbst Sachen in die Spülküche bringen)
* zum Sequenzieren an Christina wenden (über GATC Service; Eppis iun organgenen Boxen, im EG in den Briefkasten)
* im Kühlschrank gekühlte Feststoffe wie Antibiotika
*Autoklaviertape, Alufolie etc. auf dem Kühlschrank
Further Topics:
* First steps: Preparation of mediums, agarplates,.... * Work-Plan of the week: Tuesday: Competent cells (Sascha, Christophe)
Wednesday: Inoculation (Imi)
Thursday: VectorPrep (Laura, Caro) and Transformation (Hannes)
Friday:
Next Week: Individual workings(Proteinexpression) of the Argonaute team and all people that want to help
--> For this please write a message to christoph
Next Meeting: Monday 8th june, 11:00 in the Seminar room
26th may 2009, 09:00- 15:00 o'clock; Christoph
Attendees: Max, Gerrit, Christoph, SarahWe made about 200 aliquods of competent cells from the strands RV 308 and X blue (not so sure about which strands we exactly took... I will lock it up in the labbock!). Those can be used by all groups.
27th may 2009, 12:00- 15:00 o'clock; Hannes
Attendees: Imi, HannesTransformation was done with XL1 blue and the two vectors (exact name?--> pET SUMO/ pET28a). We made a control plate with XL1 (without the plasmid) as well. Plates are grown over night at 37°C. Inoculation in LB+antibiotic has to be done tomorrow (Thursday)(growth not more than 16h) and the plasmid prep on Friday.
28th may 2009, 11:00- 12:30 o'clock; Caro, Laura
*check of the three plates: Control is negative, plates with vectors are grown very well.*discussion of the expression vector of Raik Grünberg. We emailed further questions concerning the vector.
28th may 2009, 18:30 - 19:00 o'clock; Hannes
*Inoculation of 2x3ml LB+Kan with a single colony of the two transformed strains (XL1+Tt and XL1+Aa). 12-16 hours growth over night.29th may 2009, 10:30- 12:30 o'clock; Max
Attendees: Caro, Gerrit, Hannes, MaxPlasmid purification of Tt and Aa with QIAprep Spin Miniprep Kit
"


