LOCUS NC_005296 663 bp DNA linear BCT 01-MAY-2009 DEFINITION Rhodopseudomonas palustris CGA009, complete genome. ACCESSION NC_005296 REGION: complement(1707550..1708212) VERSION NC_005296.1 GI:39933080 DBLINK Project:57 KEYWORDS complete genomes. SOURCE Rhodopseudomonas palustris CGA009 ORGANISM Rhodopseudomonas palustris CGA009 Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Bradyrhizobiaceae; Rhodopseudomonas. REFERENCE 1 (bases 1 to 663) AUTHORS Larimer,F.W., Chain,P., Hauser,L., Lamerdin,J., Malfatti,S., Do,L., Land,M.L., Pelletier,D.A., Beatty,J.T., Lang,A.S., Tabita,F.R., Gibson,J.L., Hanson,T.E., Bobst,C., Torres,J.L., Peres,C., Harrison,F.H., Gibson,J. and Harwood,C.S. TITLE Complete genome sequence of the metabolically versatile photosynthetic bacterium Rhodopseudomonas palustris JOURNAL Nat. Biotechnol. 22 (1), 55-61 (2004) PUBMED 14704707 REFERENCE 2 (bases 1 to 663) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (11-SEP-2004) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 663) CONSRTM NCBI Microbial Genomes Annotation Project TITLE Direct Submission JOURNAL Submitted (24-JUL-2003) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BX571963. COMPLETENESS: full length. FEATURES Location/Qualifiers source 1..663 /organism="Rhodopseudomonas palustris CGA009" /mol_type="genomic DNA" /strain="CGA009" /db_xref="taxon:258594" gene 1..663 /locus_tag="RPA1539" /db_xref="GeneID:2691479" CDS 1..663 /locus_tag="RPA1539" /function="InterPro IPR002051" /experiment="experimental evidence, no additional details recorded" /note="observed by proteomics; Citation: Proteomics from VerBerkmoes et al. (2003) unpublished" /codon_start=1 /transl_table=11 /product="Heme oxygenase (decyclizing)" /protein_id="NP_946885.1" /db_xref="GI:39934609" /db_xref="GeneID:2691479" /translation="MVVEAAKRGAESVVTALYVRTRQLHLEAEKSGILSEILHGTAGR DGYTLLLRNLHPAYRAIEAGIERHRDNPILAPLAAHPLARTPAIESDLAALAGADWHE RLPVLPAAEAYAQRIAEVSEGDGSRLIAHAYTRYLGDLNGGQIVRRLLEKTMQLSAGE LAHYDFSAIGDPATLKTDYREALERAGAAAPDAAAVIEEGAVAFTCNIALSVAVQQHL DA" ORIGIN 1 atggtggtgg aagcagcgaa acgcggcgcc gagagcgtcg tcaccgcgtt gtatgtgcgg 61 acccgacagc tgcatctcga agccgagaaa tcgggcattc tctccgagat tctgcacggc 121 accgcagggc gcgacggcta cacgctgctg ctgcgcaatc tgcatccggc ctatcgggcg 181 atcgaagccg gcatcgagcg gcaccgcgac aatccgatcc tggcgccgct cgccgcgcat 241 ccgctggcac gcacgcccgc gatcgaatcc gacctcgccg cgcttgccgg tgcggattgg 301 cacgagcggc tgccggtgct gccggctgcc gaagcctatg cacagcggat cgcggaggtg 361 agcgaaggcg acggcagccg cctgatcgcg cacgcctaca cccgctatct cggcgacctc 421 aacggcggac agatcgtgcg tcggctgctg gagaagacca tgcagctcag cgccggcgaa 481 ctcgcccact acgacttttc ggcaatcggt gatccggcga cgttgaagac cgactatcgc 541 gaggcgctgg agcgggccgg tgctgcggct cccgatgcgg cggcggtgat cgaggaaggc 601 gcggtggcgt tcacctgcaa catcgcactg tcggtcgcgg tgcagcagca tctcgacgcc 661 tag //