|
|
(23 intermediate revisions not shown) |
Line 48: |
Line 48: |
| href="https://2009.igem.org/Team:Freiburg_bioware/Project#Summary">Summary</a> | | href="https://2009.igem.org/Team:Freiburg_bioware/Project#Summary">Summary</a> |
| </li> | | </li> |
- | <li><a | + | |
- | href="https://2009.igem.org/Team:Freiburg_bioware/Project#Subprojects">Subprojects</a></li>
| + | |
| <li><a | | <li><a |
| href="https://2009.igem.org/Team:Freiburg_bioware/Project#Highlights">Highlights</a></li> | | href="https://2009.igem.org/Team:Freiburg_bioware/Project#Highlights">Highlights</a></li> |
Line 58: |
Line 57: |
| class="t">Human | | class="t">Human |
| Practice</span></a> | | Practice</span></a> |
- | | + | <ul> |
| + | <li><a |
| + | href="https://2009.igem.org/Team:Freiburg_bioware/Human_Practice/Ethics">Ethics</a> |
| + | </li> |
| + | <li><a |
| + | href="https://2009.igem.org/Team:Freiburg_bioware/Human_Practice/Safety">Safety</a></li> |
| + | </ul> |
| + | |
| </li> | | </li> |
| <li><a href="https://2009.igem.org/Team:Freiburg_bioware/Notebook"><span class="l"></span><span | | <li><a href="https://2009.igem.org/Team:Freiburg_bioware/Notebook"><span class="l"></span><span |
Line 77: |
Line 83: |
| class="l"></span><span class="r"></span><span | | class="l"></span><span class="r"></span><span |
| class="t">Collaboration</span></a></li> | | class="t">Collaboration</span></a></li> |
| + | <li><a |
| + | href="https://2009.igem.org/Team:Freiburg_bioware/Modeling"><span |
| + | class="l"></span><span class="r"></span><span |
| + | class="t">Modeling</span></a></li> |
| </ul> | | </ul> |
| </div> | | </div> |
Line 123: |
Line 133: |
| </a><br> | | </a><br> |
| *<a href="#11">LongLinkerA50_pMA | | *<a href="#11">LongLinkerA50_pMA |
| + | </a><br> |
| + | *<a href="#12">GSAT_linker_pMA |
| + | </a><br> |
| + | *<a href="#13">SEG_Linker_pMA |
| + | </a><br> |
| + | *<a href="#14">Split_Linker_pMA |
| + | </a><br> |
| + | *<a href="#15">YFP(Venus)_pGA14 |
| + | </a><br> |
| + | *<a href="#19">Fos_pMA |
| + | </a><br> |
| + | *<a href="#16">pJS418 Vector |
| + | </a><br> |
| + | *<a href="#17">pJS419 Vector |
| + | </a><br> |
| + | *<a href="#18">pBAD Vector |
| + | </a><br> |
| + | *<a href="#20">pEX Vector |
| </a><br> | | </a><br> |
| | | |
Line 128: |
Line 156: |
| </td></tr></table> | | </td></tr></table> |
| | | |
- | | + | <li style=" text-align:center;"><a href="https://2009.igem.org/Team:Freiburg_bioware/oligos">list of oligonucleotides</a></li> |
| | | |
| | | |
Line 181: |
Line 209: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 231: |
Line 259: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 283: |
Line 311: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 334: |
Line 362: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 391: |
Line 419: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 425: |
Line 453: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 461: |
Line 489: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 499: |
Line 527: |
| | | |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 535: |
Line 563: |
| <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> | | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 571: |
Line 599: |
| <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> | | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 606: |
Line 634: |
| <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> | | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 640: |
Line 668: |
| | | |
| | | |
- | <a name="12"></a> | + | <a name="13"></a> |
| <h3 class="art-PostHeaderIcon-wrapper"> SEG_Linker_pMA <span class="art-PostHeader"></span> </h3> | | <h3 class="art-PostHeaderIcon-wrapper"> SEG_Linker_pMA <span class="art-PostHeader"></span> </h3> |
| <div class="art-PostContent"> | | <div class="art-PostContent"> |
| <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> | | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 678: |
Line 706: |
| | | |
| | | |
- | <a name="12"></a> | + | <a name="14"></a> |
- | <h3 class="art-PostHeaderIcon-wrapper"> Split_Linker_pMA <span class="art-PostHeader"></span> </h3> | + | <h3 class="art-PostHeaderIcon-wrapper"> Split_Linker_pMA (iGEM team Freiburg 08)<span class="art-PostHeader"></span> </h3> |
| <div class="art-PostContent"> | | <div class="art-PostContent"> |
| <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> | | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| | | |
- | <table border="5"> | + | <table border="5" style= "width: 100%;"> |
| <tr> | | <tr> |
| <td align="center"> | | <td align="center"> |
Line 713: |
Line 741: |
| | | |
| | | |
| + | <a name="15"></a> |
| + | <h3 class="art-PostHeaderIcon-wrapper"> YFP(Venus)_pGA14 (iGEM team Freiburg 08) <span class="art-PostHeader"></span> </h3> |
| + | <div class="art-PostContent"> |
| + | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| | | |
| + | <table border="5" style= "width: 100%;"> |
| + | <tr> |
| + | <td align="center"> |
| + | <img src="https://static.igem.org/mediawiki/2009/thumb/6/61/Freiburg09_PGA14_YFP%28Venus%29.jpg/600px-Freiburg09_PGA14_YFP%28Venus%29.jpg" name="YFP(Venus) in pGA14 Vector" width="480" height="480" /> |
| + | <br><p align="center">YFP(Venus) in pGA14 Vector</p> |
| + | <li> <a href="http://partsregistry.org/Part:BBa_K157007">link to part registry</a> |
| + | </td> |
| + | <td align="left"> |
| + | nucleotid sequence of ORF-1:<br> |
| + | ATGGCCGGCATGAGCAAAGGCGAAGAACTGTTTACCGGCGTGGTGCCGAT |
| + | TCTGGTGGAACTGGATGGTGATGTGAACGGCCATAAATTTAGCGTGAGCG |
| + | GCGAAGGCGAAGGTGATGCGACCTATGGCAAACTGACCCTGAAACTGATT |
| + | TGCACCACCGGCAAACTGCCGGTTCCGTGGCCGACCCTGGTTACCACCCT |
| + | GGGCTATGGCCTGCAATGCTTTGCGCGTTATCCGGATCATATGAAACAGC |
| + | ACGATTTCTTTAAAAGCGCCATGCCGGAAGGCTATGTGCAGGAACGCACC |
| + | ATCTTTTTTAAAGATGATGGCAACTATAAAACCCGTGCGGAAGTGAAATT |
| + | TGAAGGCGATACCCTGGTGAACCGTATTGAACTGAAAGGCATCGATTTCA |
| + | AAGAAGATGGCAACATTCTGGGCCATAAACTGGAATATAACTACAACAGC |
| + | CATAACGTGTATATCACCGCGGATAAACAGAAAAACGGCATCAAAGCGAA |
| + | CTTTAAAATCCGCCACAACATTGAAGATGGCGGCGTGCAGCTGGCCGATC |
| + | ATTATCAGCAGAACACCCCGATTGGTGATGGCCCGGTGCTGCTGCCGGAT |
| + | AACCATTATCTGAGCTACCAGAGCAAACTGAGCAAAGATCCGAACGAAAA |
| + | ACGTGACCATATGGTGCTGCTGGAATTTGTGACCGCGGCCGGTATTACCC |
| + | ATGGCATGGATGAACTGTATAAAACCGGTTAA |
| | | |
| + | </td> |
| + | </tr> |
| + | </table> |
| + | <br> |
| + | <h4>AA sequence of ORF-1:<br></h4> |
| + | <table border="0"> |
| + | <p align="justify"><td align="left"> |
| + | MAGMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPW |
| + | PTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGD |
| + | TLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQ |
| + | LADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELY |
| + | KTG |
| | | |
| | | |
| + | <br><br></p></td></table> |
| | | |
| + | <h4>Commented GenBank file</h4> |
| + | <li> <a href="https://static.igem.org/mediawiki/2009/2/2e/Freiburg09_PGA14_YFP%28Venus%29.txt">YFP(Venus)_pGA14.txt</a></li> |
| + | <br> |
| + | <br> |
| + | <br> |
| + | |
| + | |
| + | <a name="19"></a> |
| + | <h3 class="art-PostHeaderIcon-wrapper"> Fos_pMA (iGEM team Freiburg 08) <span class="art-PostHeader"></span> </h3> |
| + | <div class="art-PostContent"> |
| + | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| + | |
| + | <table border="5" style= "width: 100%;"> |
| + | <tr> |
| + | <td align="center"> |
| + | <img src="https://static.igem.org/mediawiki/2009/thumb/c/ca/Freiburg09_Fos_pMA.jpg/600px-Freiburg09_Fos_pMA.jpg" name="Fos in pMA Vector" width="480" height="480" /> |
| + | <br><p align="center">Fos) in pMA Vector</p> |
| + | <li> <a href="http://partsregistry.org/Part:BBa_K243027">link to part registry</a> |
| + | </td> |
| + | <td align="left"> |
| + | nucleotid sequence of ORF-1:<br> |
| + | ATGGCCGGCCACCATCACCACCACCATGGATCCGGTGAAGAAAAACGCCG |
| + | TATCCGTCGTGAGCGTAACAAAATGGCAGCAGCCAAATCCCGTAATCGCC |
| + | GTCGTGAGCTGACAGACACACTGCAAGCCGAAACCGATCAACTGGAGGAC |
| + | GAGAAAAGTGCTCTGCAAACTGAGATTGCCAATCTGCTGAAAGAGAAAGA |
| + | AAAACTGGAGTTCATCCTGGCAGCAACCGGTTAA |
| + | |
| + | |
| + | </td> |
| + | </tr> |
| + | </table> |
| + | <br> |
| + | <h4>AA sequence of ORF-1:<br></h4> |
| + | <table border="0"> |
| + | <p align="justify"><td align="left"> |
| + | MAGHHHHHHGSGEEKRRIRRERNKMAAAKSRNRRRELTDTLQAETDQLEDEKSALQTEIA |
| + | NLLKEKEKLEFILAATG |
| + | |
| + | |
| + | |
| + | <br><br></p></td></table> |
| + | |
| + | <h4>Commented GenBank file</h4> |
| + | <li> <a href="https://static.igem.org/mediawiki/2009/8/80/Freiburg09_Fos_pMA.txt">Fos_pMA.txt</a></li> |
| + | <br> |
| + | <br> |
| + | <br> |
| + | |
| + | |
| + | |
| + | |
| + | |
| + | |
| + | |
| + | |
| + | <a name="16"></a> |
| + | <h3 class="art-PostHeaderIcon-wrapper"> pJS418_Phagemid-dummy <span class="art-PostHeader"></span> </h3> |
| + | <div class="art-PostContent"> |
| + | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| + | |
| + | <table border="5" style= "width: 100%;"> |
| + | <tr> |
| + | <td align="center"> |
| + | <img src="https://static.igem.org/mediawiki/2009/thumb/8/84/Freiburg09_PJS418_dummy.jpg/600px-Freiburg09_PJS418_dummy.jpg" name="pJS418 Vector with strong SD sequence" width="480" height="480" /> |
| + | <br><p align="center">pJS418 Vector with strong SD sequence</p> |
| + | <li> <a href="http://partsregistry.org/Part:BBa_K243034">link to part registry</a> |
| + | </td> |
| + | <td align="center"> |
| + | |
| + | <h4>Commented GenBank file</h4> |
| + | <li> <a href="https://static.igem.org/mediawiki/2009/3/3a/Freiburg09_PJS418_dummy.txt">pJS418.txt</a></li> |
| + | </td> |
| + | </tr> |
| + | </table> |
| + | <br> |
| + | <br> |
| + | <br> |
| + | |
| + | |
| + | <a name="17"></a> |
| + | <h3 class="art-PostHeaderIcon-wrapper"> pJS419_Phagemid-dummy <span class="art-PostHeader"></span> </h3> |
| + | <div class="art-PostContent"> |
| + | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| + | |
| + | <table border="5" style= "width: 100%;"> |
| + | <tr> |
| + | <td align="center"> |
| + | <img src="https://static.igem.org/mediawiki/2009/thumb/b/b1/Freiburg09_PJS419_dummy.jpg/600px-Freiburg09_PJS419_dummy.jpg" name="pJS419 Vector with weak SD sequence" width="480" height="480" /> |
| + | <br><p align="center">pJS419 Vector with weak SD sequence</p> |
| + | <li> <a href="http://partsregistry.org/Part:BBa_K243035">link to part registry</a> |
| + | </td> |
| + | <td align="center"> |
| + | |
| + | <h4>Commented GenBank file</h4> |
| + | <li> <a href="https://static.igem.org/mediawiki/2009/d/d9/Freiburg09_PJS419_dummy.txt">pJS419.txt</a></li> |
| + | </td> |
| + | </tr> |
| + | </table> |
| + | |
| + | <br> |
| + | <br> |
| + | <br> |
| + | |
| + | |
| + | |
| + | <a name="18"></a> |
| + | <h3 class="art-PostHeaderIcon-wrapper"> pBAD_dummy <span class="art-PostHeader"></span> </h3> |
| + | <div class="art-PostContent"> |
| + | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| + | |
| + | <table border="5" style= "width: 100%;"> |
| + | <tr> |
| + | <td align="center"> |
| + | <img src="https://static.igem.org/mediawiki/2009/thumb/6/69/Freiburg09_PBAD_dummy.jpg/600px-Freiburg09_PBAD_dummy.jpg" name="pBAD Vector" width="480" height="480" /> |
| + | <br><p align="center">pBAD Vector</p> |
| + | <li> <a href="http://partsregistry.org/Part:BBa_K243037">link to part registry</a> |
| + | </td> |
| + | <td align="center"> |
| + | |
| + | <h4>Commented GenBank file</h4> |
| + | <li> <a href="https://static.igem.org/mediawiki/2009/1/1c/Freiburg09_PBAD_dummy.txt">pBAD_dummy.txt</a></li> |
| + | </td> |
| + | </tr> |
| + | </table> |
| + | |
| + | <br> |
| + | <br> |
| + | <br> |
| + | |
| + | |
| + | <a name="20"></a> |
| + | <h3 class="art-PostHeaderIcon-wrapper"> pEX_CatInsert <span class="art-PostHeader"></span> </h3> |
| + | <div class="art-PostContent"> |
| + | <div style="text-align: center;"><font size="1"><a href="#1">back to index</a></font> |
| + | |
| + | <table border="5" style= "width: 100%;"> |
| + | <tr> |
| + | <td align="center"> |
| + | <img src="https://static.igem.org/mediawiki/2009/thumb/a/a6/Freiburg09_PEX_CATInsert.jpg/600px-Freiburg09_PEX_CATInsert.jpg" name="pEX Vector" width="480" height="480" /> |
| + | <br><p align="center">pEX Vector</p> |
| + | <li> <a href="http://partsregistry.org/Part:BBa_K243033">link to part registry</a> |
| + | </td> |
| + | <td align="center"> |
| + | |
| + | <h4>Commented GenBank file</h4> |
| + | <li> <a href="https://static.igem.org/mediawiki/2009/7/7a/Freiburg09_PEX_CATInsert.txt">pEX_CatInsert.txt</a></li> |
| + | </td> |
| + | </tr> |
| + | </table> |
| + | |
| + | <br> |
| + | <br> |
| + | <br> |
| | | |
| | | |