Team:ArtScienceBangalore/Parts

From 2009.igem.org

(Difference between revisions)
 
(18 intermediate revisions not shown)
Line 1: Line 1:
<html>
<html>
-
<head>
+
<link rel="stylesheet" href="http://hackteria.org/as.css" type="text/css" />
-
<link href="https://2009.igem.org/wiki/index.php?title=User:Sem2490/wiki/sandeep.css&action=raw&ctype=text/css" rel="stylesheet" type="text/css">
+
  <div id="asMain">
-
</head>
+
    <div id="asTitle">
-
<body>
+
      <h1>Parts</h1>
-
<table>
+
    </div>
-
  <tr>
+
   
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore"> Home </a></td>
+
    <div id="asMenu">
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team"> The Team </a></td>
+
      <ul>
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Brainstorms"> Brainstorms</a></td>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li>
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project"> The Project</a></td>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team">People</a></li>
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook"> Notebook</a></td>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li>
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach"> Outreach</a></td>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project">Project</a></li>
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links"> Links</a></td>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li>
-
    <td><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery"> Gallery</a></td>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Experiments">Experiments</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links">References</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li>       
 +
          <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li>
 +
      </ul>
 +
    </div>
 +
   
 +
    <div id="asContent">
-
  </tr>
 
-
</table>
 
-
</body>
 
-
</html>
 
-
<strong>Parts</strong>
+
<strong>Here is the part that we submitted to the Standard Parts Registry- <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000"><strong>BBa_K221000</strong></a></strong><br><br>
 +
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br>
-
Here is the part that we submitted to the registry. <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000">BBa_K221000</a>
+
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>
-
This helps our construct synthasize geosmin, the enzyme that smells like rain.
+
 +
<strong> <b>Amino acid sequence:</b> </strong><br>
 +
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK<br>
 +
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM<br>
 +
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH<br>
 +
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
 +
 +
    </div>
-
===Note===
+
  </div>
-
 
+
</html>
-
If you choose to include a '''Parts Submitted to the Registry''' page, please list your parts here.  This is not necessary but it may be a nice list to keep track of.
+

Latest revision as of 21:31, 21 October 2009

Parts

Here is the part that we submitted to the Standard Parts Registry-
BBa_K221000

This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional germacradienol synthase with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.

Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT

Retrieved from "http://2009.igem.org/Team:ArtScienceBangalore/Parts"