"
Team:ArtScienceBangalore/Parts
From 2009.igem.org
(Difference between revisions)
| (4 intermediate revisions not shown) | |||
| Line 9: | Line 9: | ||
<ul> | <ul> | ||
<li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li> | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li> | ||
| - | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team"> | + | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team">People</a></li> |
<li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li> | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li> | ||
| - | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project"> | + | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project">Project</a></li> |
<li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li> | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li> | ||
<li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li> | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li> | ||
| - | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/ | + | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Experiments">Experiments</a></li> |
| + | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links">References</a></li> | ||
<li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li> | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li> | ||
<li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li> | <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li> | ||
| Line 26: | Line 27: | ||
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br> | <strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br> | ||
| - | This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. | + | This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.<br><br> |
Latest revision as of 21:31, 21 October 2009
Parts
Here is the part that we submitted to the Standard Parts Registry-
BBa_K221000
This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional germacradienol synthase with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.
Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
BBa_K221000
This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional germacradienol synthase with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.
Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
