Team:ArtScienceBangalore/Parts

From 2009.igem.org

(Difference between revisions)
 
(37 intermediate revisions not shown)
Line 1: Line 1:
-
{| style="color:#1b2c8a;background-color:#0c6;" cellpadding="3" cellspacing="1" border="1" bordercolor="#fff" width="62%" align="center"
 
-
!align="center"|[[Team:ArtScienceBangalore|Home]]
 
-
!align="center"|[[Team:ArtScienceBangalore/Team|The Team]]
 
-
!align="center"|[[Team:ArtScienceBangalore/Project|The Project]]
 
-
!align="center"|[[Team:ArtScienceBangalore/Parts|Parts Submitted to the Registry]]
 
-
!align="center"|[[Team:ArtScienceBangalore/Modeling|Modeling]]
 
-
!align="center"|[[Team:ArtScienceBangalore/Notebook|Notebook]]
 
-
|}
 
-
 
<html>
<html>
-
<div id="box" style="width: 700px; margin-left: 137px; padding: 5px; border: 3px solid #000; background-color: #fe2b33;">
+
<link rel="stylesheet" href="http://hackteria.org/as.css" type="text/css" />
-
<div id="template" style="text-align: center; font-weight: bold; font-size: large; color: #f6f6f6; padding: 5px;">
+
  <div id="asMain">
-
This is a template page. READ THESE INSTRUCTIONS.
+
    <div id="asTitle">
-
</div>
+
      <h1>Parts</h1>
-
<div id="instructions" style="text-align: center; font-weight: normal; font-size: small; color: #f6f6f6; padding: 5px;">
+
    </div>
-
You are provided with this team page template with which to start the iGEM season.  You may choose to personalize it to fit your team but keep the same "look." Or you may choose to take your team wiki to a different level and design your own wiki.  You can find some examples <a href="https://2008.igem.org/Help:Template/Examples">HERE</a>.
+
   
-
</div>
+
    <div id="asMenu">
-
<div id="warning" style="text-align: center; font-weight: bold; font-size: small; color: #f6f6f6; padding: 5px;">
+
      <ul>
-
You <strong>MUST</strong> have a team description page, a project abstract, a complete project description, and a lab notebook. PLEASE keep all of your pages within your teams namespace.
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li>
-
</div>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team">People</a></li>
-
</div>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li>
-
</html>
+
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project">Project</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Experiments">Experiments</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links">References</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li>       
 +
          <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li>
 +
      </ul>
 +
    </div>
 +
   
 +
    <div id="asContent">
-
<!-- *** End of the alert box *** -->
 
 +
<strong>Here is the part that we submitted to the Standard Parts Registry- <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000"><strong>BBa_K221000</strong></a></strong><br><br>
 +
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br>
 +
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>
-
{|align="justify"
 
-
|You can write a background of your team here.  Give us a background of your team, the members, etc.  Or tell us more about something of your choosing.
 
-
|[[Image:Example_logo.png|200px|right|frame]]
 
-
|-
 
-
|
 
-
''Tell us more about your project.  Give us background.  Use this is the abstract of your project.  Be descriptive but concise (1-2 paragraphs)''
 
-
|[[Image:Team.png|right|frame|Your team picture]]
 
-
|-
 
-
|
 
-
|align="center"|[[Team:ArtScienceBangalore | Team Example]]
 
-
|}
 
-
<!--- The Mission, Experiments --->
+
<strong> <b>Amino acid sequence:</b> </strong><br>
 +
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK<br>
 +
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM<br>
 +
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH<br>
 +
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
 +
 +
    </div>
-
(''Or you can choose different headings.  But you must have a team page, a project page, and a notebook page.'')
+
  </div>
-
 
+
</html>
-
 
+
-
===Note===
+
-
 
+
-
If you choose to include a '''Parts Submitted to the Registry''' page, please list your parts here.  This is not necessary but it may be a nice list to keep track of.
+

Latest revision as of 21:31, 21 October 2009

Parts

Here is the part that we submitted to the Standard Parts Registry-
BBa_K221000

This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional germacradienol synthase with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.

Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT

Retrieved from "http://2009.igem.org/Team:ArtScienceBangalore/Parts"