Team:ArtScienceBangalore/Parts

From 2009.igem.org

(Difference between revisions)
Line 24: Line 24:
<strong>Here is the part that we submitted to the Standard Parts Registry: <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000">BBa_K221000</a></strong><br>
<strong>Here is the part that we submitted to the Standard Parts Registry: <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000">BBa_K221000</a></strong><br>
-
<h5><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></h5><br>
+
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br>
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.<br> Expression of this domain gives a fully functional germacradienol synthase with steady-state <br> catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.<br> Expression of this domain gives a fully functional germacradienol synthase with steady-state <br> catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>
-
<strong> <b>Amino acid sequence:</b> </strong>
+
<strong> <b>Amino acid sequence:</b> </strong><br>
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLE<br>
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLE<br>

Revision as of 15:06, 21 October 2009

Parts

Here is the part that we submitted to the Standard Parts Registry:
BBa_K221000

This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.
Expression of this domain gives a fully functional germacradienol synthase with steady-state
catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.

Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLE
KYKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIE
MRRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSR
LHQFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT