"
Team:ArtScienceBangalore/Parts
From 2009.igem.org
(Difference between revisions)
| Line 23: | Line 23: | ||
| - | <strong>Here is the part that we submitted to the Standard Parts Registry: <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000">< | + | <strong>Here is the part that we submitted to the Standard Parts Registry: <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000"><strong>BBa_K221000</strong></a></strong><br> |
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br> | <strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br> | ||
| - | This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.<br> Expression of this domain gives a fully functional germacradienol synthase with steady-state <br> catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.<br><br> | + | This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.<br>Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state <br> catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.<br><br> |
Revision as of 15:09, 21 October 2009
Parts
Here is the part that we submitted to the Standard Parts Registry:
BBa_K221000
This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.
Expression of this domain gives a fully functional germacradienol synthase with steady-state
catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.
Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRL
HQFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
BBa_K221000
This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.
Expression of this domain gives a fully functional germacradienol synthase with steady-state
catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.
Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRL
HQFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
