User contributions
From 2009.igem.org
(Latest | Earliest) View (newer 100 | older 100) (20 | 50 | 100 | 250 | 500)
- 02:59, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 02:56, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 02:30, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Invasiveness
- 02:26, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 02:25, 22 October 2009 (diff | hist) N File:Differential 2.png (top)
- 02:22, 22 October 2009 (diff | hist) N File:Differential 1.png (top)
- 21:01, 21 October 2009 (diff | hist) Team:Warsaw/Project/detailed (top)
- 21:00, 21 October 2009 (diff | hist) N File:Integrin scheme.png (top)
- 20:55, 21 October 2009 (diff | hist) N File:800px-Alphavbeta3 integrin expression in tumors.png (top)
- 22:08, 20 October 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 16:39, 20 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 07:41, 18 October 2009 (diff | hist) Team:Warsaw/Project/theory (top)
- 07:40, 18 October 2009 (diff | hist) N File:Mito apo.png (top)
- 07:36, 18 October 2009 (diff | hist) N File:Coniugation.png (top)
- 07:32, 18 October 2009 (diff | hist) N File:Escape.png (top)
- 07:30, 18 October 2009 (diff | hist) Team:Warsaw/Project/introduction
- 07:28, 18 October 2009 (diff | hist) N File:Bakteryjka.png (top)
- 07:20, 18 October 2009 (diff | hist) Team:Warsaw/Project/introduction
- 07:18, 18 October 2009 (diff | hist) N File:Bacteria em.png (top)
- 00:34, 16 October 2009 (diff | hist) Team:Warsaw/Glossary
- 00:00, 16 October 2009 (diff | hist) Team:Warsaw/Glossary (Undo revision 100757 by Smaegol (Talk))
- 23:54, 15 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural (top)
- 23:37, 15 October 2009 (diff | hist) Team:Warsaw/Resources (top)
- 23:15, 15 October 2009 (diff | hist) Team:Warsaw/Human
- 08:15, 15 October 2009 (diff | hist) Team:Warsaw/Human
- 21:41, 14 October 2009 (diff | hist) Team:Warsaw/Human
- 16:24, 14 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 20:28, 12 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 20:26, 12 October 2009 (diff | hist) N File:Gnuplots phoQ.png (top)
- 19:59, 12 October 2009 (diff | hist) N File:Ramaplot phoQ.png (top)
- 19:56, 12 October 2009 (diff | hist) N File:Three models.png (top)
- 19:47, 12 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 19:36, 12 October 2009 (diff | hist) N File:Ramaplot phoP.png (top)
- 19:33, 12 October 2009 (diff | hist) N File:Gnuplots phoP.png (top)
- 19:30, 12 October 2009 (diff | hist) N File:Best models alignment.png (top)
- 19:26, 12 October 2009 (diff | hist) N File:PhoP model.png (top)
- 13:29, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 13:27, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 13:26, 11 October 2009 (diff | hist) N File:Ramaplots invasin.png (top)
- 13:22, 11 October 2009 (diff | hist) N File:Gnuplots inv.png (top)
- 13:06, 11 October 2009 (diff | hist) N File:Tasser-pdb head.png (top)
- 13:02, 11 October 2009 (diff | hist) N File:Compared models.png (top)
- 12:52, 11 October 2009 (diff | hist) N File:LLO ramaplots.png (top)
- 12:48, 11 October 2009 (diff | hist) N File:LLO gnuplot.png (top)
- 12:33, 11 October 2009 (diff | hist) N File:Model5-1-pdb alignment.png (top)
- 11:00, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 10:47, 11 October 2009 (diff | hist) N File:Gnu plots p53.png (top)
- 10:43, 11 October 2009 (diff | hist) N File:Ramachandran plots p53.png (top)
- 10:37, 11 October 2009 (diff | hist) N File:Mod5 alignment-pdb+model.png (top)
- 10:33, 11 October 2009 (diff | hist) N File:Lomets1 alignment-pdb+model.png (top)
- 09:54, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 09:49, 11 October 2009 (diff | hist) N File:Bax gnu plots.png (top)
- 09:45, 11 October 2009 (diff | hist) N File:Bax ramachandran.png (top)
- 09:43, 11 October 2009 (diff | hist) N File:Bax-topmodels.png (top)
- 09:37, 11 October 2009 (diff | hist) N File:Bax-alignment31.png (top)
- 09:15, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 09:00, 11 October 2009 (diff | hist) File:Secretion peptide-top models alignment.png (uploaded a new version of "Image:Secretion peptide-top models alignment.png") (top)
- 08:59, 11 October 2009 (diff | hist) N File:Secretion peptide-top models alignment.png
- 08:56, 11 October 2009 (diff | hist) N File:Model secretion.png (top)
- 08:49, 11 October 2009 (diff | hist) N File:Ramachandran plots secretion peptide.png (top)
- 08:44, 11 October 2009 (diff | hist) N File:Gnu plots secretion peptid.png (top)
- 08:42, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 07:08, 11 October 2009 (diff | hist) N Team:Warsaw/Modelling/Structural/secondary structures (New page: {{WarHead1}} <h3>Predicted secondary structures</h3> <h4>Secretion peptide from hemolysin A</h4> sequence <pre>GGEGNDLLKGGYGNDIYRYLSGYGHHIIDDDGGKDDKLSLADIDFRDVAFRREGNDLIMYKAEGNVLSIG HK...) (top)
- 06:52, 11 October 2009 (diff | hist) Team:Warsaw/Glossary
- 06:26, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 07:08, 8 October 2009 (diff | hist) N Team:Warsaw/Human (New page: {{WarHead1}} <h2>Cancer - important social problem</h2> According to many sources cancer remains the main cause of death in both men and women in developped countries. Between 1950 and ...)
- 23:49, 4 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 23:49, 4 October 2009 (diff | hist) N Team:Warsaw/Models evaluation (New page: {{WarHead1}} <h3>Methods to evaluate the models correctness</h3> <h4>Ramachandran plot</h4> Ramachandran plot is a plausible way to depict dihedral angles phi against psi in the amino a...) (top)
- 23:42, 4 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 08:34, 1 October 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 08:31, 1 October 2009 (diff | hist) Team:Warsaw/Modeling methods (top)
- 08:24, 1 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 18:20, 30 September 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 18:18, 30 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/29 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> Task 1: Prepare the following ligations: *[http://partsregistry.org/Part:BBa...)
- 18:15, 30 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/28 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> Task 1: Prepare the following ligations: *[http://partsregistry.org/Part:BBa...)
- 22:49, 29 September 2009 (diff | hist) N Team:Warsaw/Modelling/Structural (New page: {{WarHead1}} <h2>Introduction</h2> <div class="important">Because the native conformation of secretion peptide from hemolysin A is not determine we decided to use several computational s...)
- 22:43, 29 September 2009 (diff | hist) N Team:Warsaw/Modeling methods (New page: {{WarHead1}} <h3>Short description of used programs and servers</h3> <h4>[http://robetta.bakerlab.org/ Robetta and Rosetta]</h4> Robetta is a full-chain protein structure prediction ser...)
- 15:48, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 August 2009 (top)
- 15:45, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 August 2009 (top)
- 15:40, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 August 2009 (top)
- 15:38, 28 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/27 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Preparation of biobricks to send</h3> <h4>Marcin</h4> Task 1: Isolation of plasmid containing [http://partsregistry.org/Part:BBa_K1770...) (top)
- 15:30, 28 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/26 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Preparation of biobricks to send</h3> <h4>Marcin</h4> Task 1: Preparation of bacterial cultures (done by Kuba): '''Comment''': Kuba p...) (top)
- 15:28, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 September 2009
- 15:25, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/25 September 2009
- 21:41, 27 September 2009 (diff | hist) Team:Warsaw
- 20:00, 27 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 13:54, 27 September 2009 (diff | hist) Team:Warsaw/Glossary
- 20:03, 26 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 18:35, 26 September 2009 (diff | hist) Team:Warsaw/Modelling/Apoptosis
- 16:26, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 July 2009 (top)
- 16:23, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/27 July 2009 (top)
- 16:21, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/25 July 2009 (top)
- 16:17, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009 (top)
- 16:15, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 July 2009 (top)
- 16:12, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009 (top)
- 15:58, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 July 2009
- 15:53, 26 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/24 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> <strong>Comment:</strong> Result of following ligations was disappointing (...)
- 15:32, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 September 2009
- 15:17, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 September 2009 (top)
- 15:13, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 September 2009
(Latest | Earliest) View (newer 100 | older 100) (20 | 50 | 100 | 250 | 500)