Team:ArtScienceBangalore/Parts

From 2009.igem.org

(Difference between revisions)
 
(3 intermediate revisions not shown)
Line 9: Line 9:
       <ul>
       <ul>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li>
-
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team">The Team</a></li>
+
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team">People</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li>
-
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project">The Project</a></li>
+
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project">Project</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li>
-
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links">Links</a></li>
+
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Experiments">Experiments</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links">References</a></li>
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li>         
         <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li>         
           <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li>
           <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li>
Line 26: Line 27:
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br>
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br>
-
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3.<br>Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state catalytic <br> parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>
+
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>

Latest revision as of 21:31, 21 October 2009

Parts

Here is the part that we submitted to the Standard Parts Registry-
BBa_K221000


This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional germacradienol synthase with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.

Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT