Team:ArtScienceBangalore/Parts

From 2009.igem.org

(Difference between revisions)
 
(25 intermediate revisions not shown)
Line 1: Line 1:
-
{| style="color:#2F1403;background-color:#FFFFFF;" cellpadding="2" cellspacing="1" border="1" bordercolor="#fff" width="62%" align="center"
+
<html>
-
!align="center"|[[Team:ArtScienceBangalore|HOME]]
+
<link rel="stylesheet" href="http://hackteria.org/as.css" type="text/css" />
-
!align="center"|[[Team:ArtScienceBangalore/Team|TEAM]]
+
  <div id="asMain">
-
!align="center"|[[Team:ArtScienceBangalore/Project|PROJECT]]
+
    <div id="asTitle">
-
!align="center"|[[Team:ArtScienceBangalore/Parts|REGISTRY PARTS]]
+
      <h1>Parts</h1>
-
!align="center"|[[Team:ArtScienceBangalore/Modeling|EXPERIMENTS]]
+
    </div>
-
!align="center"|[[Team:ArtScienceBangalore/Notebook|NOTEBOOK]]
+
   
-
!align="center"|[[Team:ArtScienceBangalore/Link|LINKS]]
+
    <div id="asMenu">
-
|}
+
      <ul>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore">Home</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Team">People</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Aproach">Approach</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Project">Project</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Notebook">Notebook</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Outreach">Outreach</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Experiments">Experiments</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Links">References</a></li>
 +
        <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Gallery">Gallery</a></li>       
 +
          <li><a href="https://2009.igem.org/Team:ArtScienceBangalore/Safety">Safety</a></li>
 +
      </ul>
 +
    </div>
 +
   
 +
    <div id="asContent">
-
{|align="justify"
 
-
|You can write a background of your team here.  Give us a background of your team, the members, etc.  Or tell us more about something of your choosing.
 
-
|[[Image:ArtScience_Logo.gif|200px|left|frame]]
 
-
|-
 
-
|
 
-
''Tell us more about your project.  Give us background.  Use this is the abstract of your project.  Be descriptive but concise (1-2 paragraphs)''
 
-
|[[Image:Photo_61.jpg|right|frame|From left to right:Gautam, Nikhil, Sandeep, Dhruv, Avni, Sanya, Krupakar(the guy behind), Upasna and Akash
 
-
                Invisible: Neha]]
 
-
|-
 
-
|
 
-
|align="center"|[[Team:ArtScienceBangalore | Team Example]]
 
-
|}
 
-
<!--- The Mission, Experiments --->
+
<strong>Here is the part that we submitted to the Standard Parts Registry- <br> <a href="http://partsregistry.org/wiki/index.php?title=Part:BBa_K221000"><strong>BBa_K221000</strong></a></strong><br><br>
 +
<strong><i>This helps our construct synthesize geosmin, the enzyme that smells like rain.</i></strong><br>
 +
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional <i>germacradienol synthase</i> with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to  Geosmin*.<br><br>
-
(''Or you can choose different headings.  But you must have a team page, a project page, and a notebook page.'')
 
 +
<strong> <b>Amino acid sequence:</b> </strong><br>
-
===Note===
+
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK<br>
 +
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM<br>
 +
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH<br>
 +
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT
 +
 +
    </div>
-
If you choose to include a '''Parts Submitted to the Registry''' page, please list your parts here.  This is not necessary but it may be a nice list to keep track of.
+
  </div>
 +
</html>

Latest revision as of 21:31, 21 October 2009

Parts

Here is the part that we submitted to the Standard Parts Registry-
BBa_K221000


This helps our construct synthesize geosmin, the enzyme that smells like rain.
This part codes N-terminal (366 amino acid) domain of the SCO6073 gene from S. coelicolor A3. Expression of this domain gives a fully functional germacradienol synthase with steady-state catalytic parameters similar to those of the full-length protein that converts farnesyl diphosphate(FPP) to Geosmin*.

Amino acid sequence:
MTQQPFQLPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLEAHDYGLLCAYTHPDCDGPALSLITDWYVWVFFFDDHFLEK
YKRSQDRLAGKAHLDRLPLFMPLDDAAGMPEPRNPVEAGLADLWTRTVPAMSADWRRRFAVATEHLLNESMWELSNINEGRVANPVEYIEM
RRKVGGAPWSAGLVEYATAEVPAAVAGTRPLRVLMETFSDAVHLRNDLFSYQREVEDEGELSNGVLVLETFFGCTTQEAADLVNDVLTSRLH
QFEHTAFTEVPAVALEKGLTPLEVAAVGAYTKGLQDWQSGGHEWHMRSSRYMNKGERPLAGWQALTGPGTSAADVGALLADAVAQRARSYT