User contributions
From 2009.igem.org
(Latest | Earliest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 02:59, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 02:56, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 02:30, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Invasiveness
- 02:26, 22 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 02:25, 22 October 2009 (diff | hist) N File:Differential 2.png (top)
- 02:22, 22 October 2009 (diff | hist) N File:Differential 1.png (top)
- 21:01, 21 October 2009 (diff | hist) Team:Warsaw/Project/detailed (top)
- 21:00, 21 October 2009 (diff | hist) N File:Integrin scheme.png (top)
- 20:55, 21 October 2009 (diff | hist) N File:800px-Alphavbeta3 integrin expression in tumors.png (top)
- 22:08, 20 October 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 16:39, 20 October 2009 (diff | hist) Team:Warsaw/Modelling/Gene Networks
- 07:41, 18 October 2009 (diff | hist) Team:Warsaw/Project/theory (top)
- 07:40, 18 October 2009 (diff | hist) N File:Mito apo.png (top)
- 07:36, 18 October 2009 (diff | hist) N File:Coniugation.png (top)
- 07:32, 18 October 2009 (diff | hist) N File:Escape.png (top)
- 07:30, 18 October 2009 (diff | hist) Team:Warsaw/Project/introduction
- 07:28, 18 October 2009 (diff | hist) N File:Bakteryjka.png (top)
- 07:20, 18 October 2009 (diff | hist) Team:Warsaw/Project/introduction
- 07:18, 18 October 2009 (diff | hist) N File:Bacteria em.png (top)
- 00:34, 16 October 2009 (diff | hist) Team:Warsaw/Glossary
- 00:00, 16 October 2009 (diff | hist) Team:Warsaw/Glossary (Undo revision 100757 by Smaegol (Talk))
- 23:54, 15 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural (top)
- 23:37, 15 October 2009 (diff | hist) Team:Warsaw/Resources (top)
- 23:15, 15 October 2009 (diff | hist) Team:Warsaw/Human
- 08:15, 15 October 2009 (diff | hist) Team:Warsaw/Human
- 21:41, 14 October 2009 (diff | hist) Team:Warsaw/Human
- 16:24, 14 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 20:28, 12 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 20:26, 12 October 2009 (diff | hist) N File:Gnuplots phoQ.png (top)
- 19:59, 12 October 2009 (diff | hist) N File:Ramaplot phoQ.png (top)
- 19:56, 12 October 2009 (diff | hist) N File:Three models.png (top)
- 19:47, 12 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 19:36, 12 October 2009 (diff | hist) N File:Ramaplot phoP.png (top)
- 19:33, 12 October 2009 (diff | hist) N File:Gnuplots phoP.png (top)
- 19:30, 12 October 2009 (diff | hist) N File:Best models alignment.png (top)
- 19:26, 12 October 2009 (diff | hist) N File:PhoP model.png (top)
- 13:29, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 13:27, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 13:26, 11 October 2009 (diff | hist) N File:Ramaplots invasin.png (top)
- 13:22, 11 October 2009 (diff | hist) N File:Gnuplots inv.png (top)
- 13:06, 11 October 2009 (diff | hist) N File:Tasser-pdb head.png (top)
- 13:02, 11 October 2009 (diff | hist) N File:Compared models.png (top)
- 12:52, 11 October 2009 (diff | hist) N File:LLO ramaplots.png (top)
- 12:48, 11 October 2009 (diff | hist) N File:LLO gnuplot.png (top)
- 12:33, 11 October 2009 (diff | hist) N File:Model5-1-pdb alignment.png (top)
- 11:00, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 10:47, 11 October 2009 (diff | hist) N File:Gnu plots p53.png (top)
- 10:43, 11 October 2009 (diff | hist) N File:Ramachandran plots p53.png (top)
- 10:37, 11 October 2009 (diff | hist) N File:Mod5 alignment-pdb+model.png (top)
- 10:33, 11 October 2009 (diff | hist) N File:Lomets1 alignment-pdb+model.png (top)
- 09:54, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 09:49, 11 October 2009 (diff | hist) N File:Bax gnu plots.png (top)
- 09:45, 11 October 2009 (diff | hist) N File:Bax ramachandran.png (top)
- 09:43, 11 October 2009 (diff | hist) N File:Bax-topmodels.png (top)
- 09:37, 11 October 2009 (diff | hist) N File:Bax-alignment31.png (top)
- 09:15, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 09:00, 11 October 2009 (diff | hist) File:Secretion peptide-top models alignment.png (uploaded a new version of "Image:Secretion peptide-top models alignment.png") (top)
- 08:59, 11 October 2009 (diff | hist) N File:Secretion peptide-top models alignment.png
- 08:56, 11 October 2009 (diff | hist) N File:Model secretion.png (top)
- 08:49, 11 October 2009 (diff | hist) N File:Ramachandran plots secretion peptide.png (top)
- 08:44, 11 October 2009 (diff | hist) N File:Gnu plots secretion peptid.png (top)
- 08:42, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 07:08, 11 October 2009 (diff | hist) N Team:Warsaw/Modelling/Structural/secondary structures (New page: {{WarHead1}} <h3>Predicted secondary structures</h3> <h4>Secretion peptide from hemolysin A</h4> sequence <pre>GGEGNDLLKGGYGNDIYRYLSGYGHHIIDDDGGKDDKLSLADIDFRDVAFRREGNDLIMYKAEGNVLSIG HK...) (top)
- 06:52, 11 October 2009 (diff | hist) Team:Warsaw/Glossary
- 06:26, 11 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 07:08, 8 October 2009 (diff | hist) N Team:Warsaw/Human (New page: {{WarHead1}} <h2>Cancer - important social problem</h2> According to many sources cancer remains the main cause of death in both men and women in developped countries. Between 1950 and ...)
- 23:49, 4 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 23:49, 4 October 2009 (diff | hist) N Team:Warsaw/Models evaluation (New page: {{WarHead1}} <h3>Methods to evaluate the models correctness</h3> <h4>Ramachandran plot</h4> Ramachandran plot is a plausible way to depict dihedral angles phi against psi in the amino a...) (top)
- 23:42, 4 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 08:34, 1 October 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 08:31, 1 October 2009 (diff | hist) Team:Warsaw/Modeling methods (top)
- 08:24, 1 October 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 18:20, 30 September 2009 (diff | hist) Team:Warsaw/Modelling/Structural
- 18:18, 30 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/29 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> Task 1: Prepare the following ligations: *[http://partsregistry.org/Part:BBa...)
- 18:15, 30 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/28 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> Task 1: Prepare the following ligations: *[http://partsregistry.org/Part:BBa...)
- 22:49, 29 September 2009 (diff | hist) N Team:Warsaw/Modelling/Structural (New page: {{WarHead1}} <h2>Introduction</h2> <div class="important">Because the native conformation of secretion peptide from hemolysin A is not determine we decided to use several computational s...)
- 22:43, 29 September 2009 (diff | hist) N Team:Warsaw/Modeling methods (New page: {{WarHead1}} <h3>Short description of used programs and servers</h3> <h4>[http://robetta.bakerlab.org/ Robetta and Rosetta]</h4> Robetta is a full-chain protein structure prediction ser...)
- 15:48, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 August 2009 (top)
- 15:45, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 August 2009 (top)
- 15:40, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 August 2009 (top)
- 15:38, 28 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/27 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Preparation of biobricks to send</h3> <h4>Marcin</h4> Task 1: Isolation of plasmid containing [http://partsregistry.org/Part:BBa_K1770...) (top)
- 15:30, 28 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/26 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Preparation of biobricks to send</h3> <h4>Marcin</h4> Task 1: Preparation of bacterial cultures (done by Kuba): '''Comment''': Kuba p...) (top)
- 15:28, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 September 2009
- 15:25, 28 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/25 September 2009
- 21:41, 27 September 2009 (diff | hist) Team:Warsaw
- 20:00, 27 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 13:54, 27 September 2009 (diff | hist) Team:Warsaw/Glossary
- 20:03, 26 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 18:35, 26 September 2009 (diff | hist) Team:Warsaw/Modelling/Apoptosis
- 16:26, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 July 2009 (top)
- 16:23, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/27 July 2009 (top)
- 16:21, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/25 July 2009 (top)
- 16:17, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009 (top)
- 16:15, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 July 2009 (top)
- 16:12, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009 (top)
- 15:58, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 July 2009
- 15:53, 26 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/24 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> <strong>Comment:</strong> Result of following ligations was disappointing (...)
- 15:32, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 September 2009
- 15:17, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 September 2009 (top)
- 15:13, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 September 2009
- 15:09, 26 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/11 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3><div style="text-align: center;">Assembly of fusion proteins</div></h3> <h4>Marcin</h4> Task 1: Prepare the ligation of PCR-amplified sig...) (top)
- 15:01, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/18 September 2009 (top)
- 14:49, 26 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 September 2009 (top)
- 13:12, 24 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 September 2009
- 13:10, 24 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/22 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Preparatio of biobricks to send</h3> <h4>Marcin</h4> Task 1: Preparation of bacterial cultures: '''Comment''': I prepare liquid bacte...)
- 12:46, 24 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 September 2009
- 12:44, 24 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/21 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection operon</h3> <h4>Marcin</h4> Task 1: Isolation of [http://partsregistry.org/Part:pSB1A3<span style="color:...)
- 09:34, 24 September 2009 (diff | hist) Team:Warsaw
- 09:33, 24 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 09:07, 24 September 2009 (diff | hist) Team:Warsaw/Primers
- 08:57, 24 September 2009 (diff | hist) Team:Warsaw/Primers
- 08:16, 24 September 2009 (diff | hist) Team:Warsaw/Bibliography
- 08:15, 24 September 2009 (diff | hist) Team:Warsaw/Bibliography
- 07:04, 24 September 2009 (diff | hist) Team:Warsaw/Bibliography
- 10:52, 23 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 23:00, 21 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 July 2009 (top)
- 22:50, 21 September 2009 (diff | hist) Team:Warsaw/Team
- 22:46, 21 September 2009 (diff | hist) N File:Nucleotide logo.png (top)
- 22:04, 21 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 September 2009
- 22:03, 21 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 September 2009
- 22:47, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/19 July 2009 (top)
- 22:45, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/18 July 2009 (top)
- 22:40, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 July 2009 (top)
- 22:36, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009 (top)
- 22:32, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009 (top)
- 22:28, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 September 2009
- 22:28, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 September 2009
- 22:28, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 September 2009
- 22:28, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 September 2009 (top)
- 22:26, 20 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/20 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> Task 1: Prepare bacterial culture to isolate [http://partsregistry.org/Part:BBa_K177044<span style="color: black">BBa_K177044</span>]. Task...)
- 22:24, 20 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/19 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> '''Informal meeting of Pawinskiego group''' Members: * Paweł * Marcin * Kuba * Jarek (contact by phone) We discussed about some technical ...) (top)
- 22:20, 20 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/18 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3>Assembly of endosome detection module:</h3> <h4>Marcin</h4> Task 1: Transformation of TOP10 bacterial strain with [http://partsregistry....)
- 22:16, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 September 2009 (top)
- 22:00, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 September 2009
- 21:40, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 September 2009
- 21:37, 20 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 September 2009
- 15:09, 20 September 2009 (diff | hist) Team:Warsaw/Team/Miecznikowa
- 21:38, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009 (top)
- 21:37, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009
- 21:35, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009 (top)
- 21:21, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/12 July 2009 (top)
- 21:17, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 July 2009 (top)
- 21:10, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/9 July 2009 (top)
- 21:03, 19 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 July 2009 (top)
- 20:49, 19 September 2009 (diff | hist) Team:Warsaw/Team
- 20:17, 19 September 2009 (diff | hist) N Team:Warsaw/Gallery (New page: {{WarHead1}} <div class="important">Our pictures should be here but now you see only a black hole</div> center)
- 20:15, 19 September 2009 (diff | hist) N File:Black hole.jpg (top)
- 20:10, 19 September 2009 (diff | hist) Team:Warsaw/Sources
- 20:03, 19 September 2009 (diff | hist) Team:Warsaw/Team/Miecznikowa
- 19:57, 19 September 2009 (diff | hist) Team:Warsaw/Team/Pawinskiego
- 19:28, 19 September 2009 (diff | hist) Team:Warsaw/Acknowledgements
- 19:11, 19 September 2009 (diff | hist) Team:Warsaw/Modelling/Apoptosis
- 19:00, 19 September 2009 (diff | hist) Template:WarHead4
- 18:59, 19 September 2009 (diff | hist) Template:WarHead4
- 18:55, 19 September 2009 (diff | hist) Team:Warsaw/Modelling/Apoptosis
- 18:55, 19 September 2009 (diff | hist) Template:WarHead4
- 18:53, 19 September 2009 (diff | hist) Template:WarHead4
- 18:51, 19 September 2009 (diff | hist) Template:WarHead4
- 18:37, 19 September 2009 (diff | hist) File:Apo 7.png (uploaded a new version of "Image:Apo 7.png") (top)
- 18:30, 19 September 2009 (diff | hist) N File:Apo 8.png (top)
- 18:28, 19 September 2009 (diff | hist) N File:Apo 7.5.png (top)
- 18:27, 19 September 2009 (diff | hist) N File:Apo 7.png
- 18:27, 19 September 2009 (diff | hist) N File:Apo 6.png (top)
- 18:26, 19 September 2009 (diff | hist) N File:Apo 5.png (top)
- 18:25, 19 September 2009 (diff | hist) N File:Apo 4.png (top)
- 18:25, 19 September 2009 (diff | hist) N File:Apo 3.png (top)
- 18:24, 19 September 2009 (diff | hist) N File:Apo 2.png (top)
- 18:22, 19 September 2009 (diff | hist) N File:Apo 1.png (top)
- 18:13, 19 September 2009 (diff | hist) N File:Caspase-8 cleavage.png (top)
- 08:56, 19 September 2009 (diff | hist) Team:Warsaw
- 08:54, 19 September 2009 (diff | hist) Team:Warsaw/Team
- 08:49, 19 September 2009 (diff | hist) Team:Warsaw/protocols
- 12:08, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/7 July 2009 (top)
- 12:02, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 July 2009 (top)
- 11:57, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 July 2009
- 11:56, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 July 2009 (top)
- 11:55, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 July 2009 (top)
- 11:54, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 July 2009 (top)
- 11:46, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 September 2009 (top)
- 11:25, 18 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 September 2009 (top)
- 21:05, 17 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/10 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3><div style="text-align: center;">Assembly of fusion proteins</div></h3> <h4>Marcin</h4> Task 1: *Digest plasmids isolated in [http://2009...)
- 18:05, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 July 2009 (top)
- 18:03, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/1 July 2009 (top)
- 18:00, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/30 June 2009 (top)
- 17:57, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/29 June 2009 (top)
- 17:53, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 June 2009 (top)
- 17:50, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/18 June 2009 (top)
- 17:48, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009 (top)
- 17:46, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 May 2009 (top)
- 17:44, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 May 2009 (top)
- 17:42, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/12 May 2009 (top)
- 17:39, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/11 May 2009 (top)
- 17:26, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 May 2009 (top)
- 15:13, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 May 2009 (top)
- 15:10, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 May 2009 (top)
- 15:08, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/30 April 2009 (top)
- 15:05, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 April 2009 (top)
- 15:04, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 April 2009 (top)
- 15:02, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 April 2009 (top)
- 14:52, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 April 2009 (top)
- 14:50, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 April 2009 (top)
- 14:41, 17 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 April 2009 (top)
- 05:57, 17 September 2009 (diff | hist) Team:Warsaw
- 06:23, 16 September 2009 (diff | hist) Team:Warsaw/Resources
- 23:18, 15 September 2009 (diff | hist) Team:Warsaw/Parts
- 23:15, 15 September 2009 (diff | hist) N File:Parts alegory.png (top)
- 23:10, 15 September 2009 (diff | hist) Team:Warsaw/Resources
- 23:07, 15 September 2009 (diff | hist) N File:3D-SIM-4 Anaphase 3 color.jpg (top)
- 23:02, 15 September 2009 (diff | hist) N File:Halo genome.jpg (top)
- 23:00, 15 September 2009 (diff | hist) Team:Warsaw/Notebook
- 22:58, 15 September 2009 (diff | hist) N File:200px-GreenSandglass.svg.png (top)
- 22:48, 15 September 2009 (diff | hist) N File:133px-GreenSandglass.svg.png (top)
- 22:45, 15 September 2009 (diff | hist) Team:Warsaw/protocols
- 22:44, 15 September 2009 (diff | hist) Team:Warsaw/protocols
- 22:41, 15 September 2009 (diff | hist) N File:Agar plate with colonies.jpg (top)
- 22:36, 15 September 2009 (diff | hist) Team:Warsaw/Resources
- 22:35, 15 September 2009 (diff | hist) Team:Warsaw/Parts
- 22:33, 15 September 2009 (diff | hist) Team:Warsaw/Sources
- 22:27, 15 September 2009 (diff | hist) Team:Warsaw/Primers
- 22:24, 15 September 2009 (diff | hist) Team:Warsaw/Primers
- 17:59, 15 September 2009 (diff | hist) Team:Warsaw/Team/Miecznikowa
- 17:58, 15 September 2009 (diff | hist) Team:Warsaw/Team/Pawinskiego
- 17:57, 15 September 2009 (diff | hist) Team:Warsaw/Team/Miecznikowa
- 17:55, 15 September 2009 (diff | hist) Team:Warsaw/Team
- 17:39, 15 September 2009 (diff | hist) Team:Warsaw/sponsors
- 17:33, 15 September 2009 (diff | hist) Team:Warsaw
- 05:48, 14 September 2009 (diff | hist) Team:Warsaw/Team
- 05:47, 14 September 2009 (diff | hist) Team:Warsaw/Glossary
- 05:37, 14 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 September 2009 (top)
- 05:37, 14 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/13 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> Task 1 * Prepare bacterial cultures f...)
- 05:28, 14 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 August 2009 (top)
- 05:25, 14 September 2009 (diff | hist) N File:E0022+RBS C0051+RBS digest 28 08 09.png (top)
- 05:22, 14 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 August 2009 (top)
- 05:19, 14 September 2009 (diff | hist) N File:R0080 C0040+RBS 23 08 09.png (top)
- 05:19, 14 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 August 2009 (top)
- 05:13, 14 September 2009 (diff | hist) N File:P53+RBS cro+RBS 22 08 09.png (top)
- 22:55, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 August 2009 (top)
- 22:50, 13 September 2009 (diff | hist) N File:C0040+RBS 20 08 09.png (top)
- 22:48, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/19 August 2009 (top)
- 22:38, 13 September 2009 (diff | hist) N File:C0040+RBS cro 19 08 09.png (top)
- 21:29, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/18 August 2009 (top)
- 21:27, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 August 2009 (top)
- 21:22, 13 September 2009 (diff | hist) N File:PSB p53 R0080 C0040+RBS digest 18 08 09.png (top)
- 21:20, 13 September 2009 (diff | hist) N File:PSB p53 R0080 C0040+RBS gel out ocena 18 08 09.png (top)
- 21:18, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 August 2009
- 21:16, 13 September 2009 (diff | hist) N File:Isolation 17 08 09.png (top)
- 21:12, 13 September 2009 (diff | hist) N File:Digest 17 08 09.png (top)
- 21:09, 13 September 2009 (diff | hist) m Team:Warsaw/Calendar-Main/15 August 2009 (top)
- 21:03, 13 September 2009 (diff | hist) N File:Control gel out 15 08 09.png (top)
- 21:01, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 August 2009
- 20:48, 13 September 2009 (diff | hist) N File:P53 R0080 E0022 C0040 B0032 digest 14 08 09.png (top)
- 20:44, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 August 2009 (top)
- 20:35, 13 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 August 2009
- 20:28, 13 September 2009 (diff | hist) N File:Gel outs 13 08 09.png (top)
- 12:02, 11 September 2009 (diff | hist) Team:Warsaw/Glossary
- 11:57, 11 September 2009 (diff | hist) N File:Integrin 1.png (top)
- 11:55, 11 September 2009 (diff | hist) N File:Integrin chimera.png (top)
- 11:04, 11 September 2009 (diff | hist) Team:Warsaw/Glossary
- 11:02, 11 September 2009 (diff | hist) N File:Cro DNA 3.png (top)
- 10:55, 11 September 2009 (diff | hist) N File:Cro 2.png (top)
- 10:48, 11 September 2009 (diff | hist) Team:Warsaw/Glossary
- 09:46, 11 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 September 2009
- 09:43, 11 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 September 2009
- 09:40, 11 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009 (top)
- 09:29, 11 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 September 2009 (top)
- 09:28, 11 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 September 2009
- 09:24, 11 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 September 2009 (top)
- 07:38, 11 September 2009 (diff | hist) Team:Warsaw/Glossary
- 07:38, 11 September 2009 (diff | hist) Team:Warsaw/Glossary
- 07:30, 11 September 2009 (diff | hist) N File:Cytuchrome c subunit VIIl.png (top)
- 07:27, 11 September 2009 (diff | hist) N File:Cytuchrome c overall.png (top)
- 07:22, 11 September 2009 (diff | hist) N File:Internalin 1.png (top)
- 07:18, 11 September 2009 (diff | hist) N File:Internalin complex 5.png (top)
- 13:47, 10 September 2009 (diff | hist) Team:Warsaw/Project/theory
- 13:38, 10 September 2009 (diff | hist) Team:Warsaw/Glossary
- 13:35, 10 September 2009 (diff | hist) N File:724px-Mitochondrial DNA and diseases.png (top)
- 13:29, 10 September 2009 (diff | hist) N File:YFP 5.png (top)
- 13:26, 10 September 2009 (diff | hist) N File:YFP 2.png (top)
- 02:00, 10 September 2009 (diff | hist) Team:Warsaw/Glossary
- 01:58, 10 September 2009 (diff | hist) Team:Warsaw/Glossary
- 21:47, 9 September 2009 (diff | hist) Team:Warsaw/Glossary
- 21:46, 9 September 2009 (diff | hist) Team:Warsaw/Glossary
- 21:39, 9 September 2009 (diff | hist) Team:Warsaw/Glossary
- 21:35, 9 September 2009 (diff | hist) Team:Warsaw/Glossary
- 21:31, 9 September 2009 (diff | hist) N File:LacI IPTG 1.png (top)
- 20:41, 9 September 2009 (diff | hist) N File:TetR+DNA 2.png (top)
- 20:38, 9 September 2009 (diff | hist) N File:TetR 4.png (top)
- 19:28, 9 September 2009 (diff | hist) Team:Warsaw/Glossary
- 19:20, 9 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/9 September 2009
- 08:01, 9 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 September 2009
- 07:39, 9 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009
- 07:39, 9 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009
- 07:36, 9 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/7 September 2009
- 19:39, 8 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/7 September 2009
- 16:56, 8 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 September 2009
- 16:55, 8 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 September 2009
- 16:32, 8 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 September 2009
- 16:31, 8 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 September 2009
- 00:45, 7 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/6 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> Task:1 * Transformation of chemocompe...)
- 00:30, 7 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009
- 00:29, 7 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009
- 00:27, 7 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009
- 00:27, 7 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 September 2009
- 00:15, 7 September 2009 (diff | hist) Template:WarHead4
- 00:13, 7 September 2009 (diff | hist) Template:WarHead4
- 23:46, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/27 August 2009
- 20:09, 6 September 2009 (diff | hist) Team:Warsaw/Glossary
- 20:02, 6 September 2009 (diff | hist) Team:Warsaw/Glossary
- 19:56, 6 September 2009 (diff | hist) N File:Transport ligand.png (top)
- 19:54, 6 September 2009 (diff | hist) N File:Transport 1.png (top)
- 19:47, 6 September 2009 (diff | hist) N File:P53 with DNA.png (top)
- 19:40, 6 September 2009 (diff | hist) N File:P53 2vmd.png (top)
- 19:18, 6 September 2009 (diff | hist) N File:Hemolysin 2.png (top)
- 19:11, 6 September 2009 (diff | hist) N File:Pore 2.png (top)
- 18:52, 6 September 2009 (diff | hist) N File:LacI o3 4.png (top)
- 18:29, 6 September 2009 (diff | hist) N File:Invasin head domain.png (top)
- 18:25, 6 September 2009 (diff | hist) N File:Invasin 5.png (top)
- 18:12, 6 September 2009 (diff | hist) N File:Rab9 endosome.jpg (top)
- 18:00, 6 September 2009 (diff | hist) N File:Bax Soluble Jmol.jpg (top)
- 18:00, 6 September 2009 (diff | hist) Team:Warsaw/Glossary
- 16:37, 6 September 2009 (diff | hist) N File:Apoptosis stained.jpg (top)
- 16:33, 6 September 2009 (diff | hist) N File:Signal transduction pathways.png (top)
- 13:52, 6 September 2009 (diff | hist) Team:Warsaw/Glossary
- 09:27, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/12 August 2009 (top)
- 09:15, 6 September 2009 (diff | hist) N File:Crobox digest 12 08 09.png (top)
- 09:12, 6 September 2009 (diff | hist) N File:R0080 E0022 cro digest 12 08 09.png (top)
- 08:28, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/11 August 2009 (top)
- 08:22, 6 September 2009 (diff | hist) N File:Digest 11 08 09.png (top)
- 08:20, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 August 2009 (top)
- 08:15, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 August 2009 (top)
- 08:12, 6 September 2009 (diff | hist) N File:Cro digest SpeI PstI 08 08 09.png (top)
- 08:09, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/7 August 2009 (top)
- 08:06, 6 September 2009 (diff | hist) N File:C0040 digest 07 08 09.png (top)
- 08:01, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 August 2009 (top)
- 07:53, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 August 2009
- 07:50, 6 September 2009 (diff | hist) N File:P53+pSB digest Xba+Pst 06 08 09.png (top)
- 07:43, 6 September 2009 (diff | hist) N File:P53+pSB isolation 06 08 09.png (top)
- 07:38, 6 September 2009 (diff | hist) N File:P53 digest 06 08 09.png (top)
- 07:25, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 August 2009 (top)
- 07:19, 6 September 2009 (diff | hist) N File:C0040 digest 04 08 09.png (top)
- 07:17, 6 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 August 2009 (top)
- 06:45, 6 September 2009 (diff | hist) N File:P53 pSB gel out 03 08 09.png (top)
- 12:02, 5 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 August 2009
- 10:20, 5 September 2009 (diff | hist) Team:Warsaw/Project/theory
- 10:20, 5 September 2009 (diff | hist) Team:Warsaw/Project/detailed
- 09:23, 5 September 2009 (diff | hist) Team:Warsaw/Project/theory
- 08:48, 5 September 2009 (diff | hist) Team:Warsaw/Project/introduction
- 08:39, 4 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 September 2009
- 08:38, 4 September 2009 (diff | hist) N Team:Warsaw/Calendar-Main/2 September 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p><ul><li>Re...)
- 23:30, 3 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 August 2009
- 22:48, 3 September 2009 (diff | hist) Team:Warsaw/Calendar-Main/27 August 2009
- 10:47, 29 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/16 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p><ul><li>Tra...) (top)
- 07:00, 29 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/15 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul><li>Ge...)
- 06:03, 25 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/23 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br /> <p>Task 1:</p><ul> <li>...)
- 05:58, 25 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 August 2009
- 05:55, 25 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 August 2009
- 05:55, 25 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 August 2009
- 05:47, 25 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/22 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>E...)
- 05:27, 25 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/21 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p><ul><li>Pre...)
- 05:13, 25 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 August 2009
- 05:19, 20 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/19 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>...)
- 05:08, 19 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/18 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>...)
- 04:49, 19 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/17 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>...)
- 04:41, 19 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 August 2009
- 12:40, 17 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 August 2009
- 11:49, 17 August 2009 (diff | hist) Team:Warsaw/Primers
- 11:36, 17 August 2009 (diff | hist) Team:Warsaw/Primers
- 11:35, 17 August 2009 (diff | hist) Team:Warsaw/Primers
- 05:57, 17 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 August 2009
- 05:36, 17 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 August 2009
- 05:27, 17 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 August 2009
- 05:09, 17 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 August 2009
- 05:06, 17 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 August 2009
- 13:26, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/12 August 2009
- 13:25, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 August 2009
- 13:21, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 August 2009
- 13:19, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 August 2009
- 12:23, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 August 2009
- 12:18, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 August 2009
- 12:10, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 August 2009
- 11:29, 14 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 August 2009
- 19:05, 13 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/12 August 2009
- 18:35, 13 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/12 August 2009
- 18:18, 13 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/11 August 2009
- 18:15, 13 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/11 August 2009
- 17:45, 13 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/12 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>...)
- 17:35, 13 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/11 August 2009
- 17:27, 13 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/10 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p><b>Comment:</b></p> ...)
- 17:09, 13 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 15:21, 12 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/11 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>...)
- 12:05, 12 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/9 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li...) (top)
- 12:03, 12 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/7 August 2009
- 12:01, 12 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/8 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li...)
- 06:31, 8 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/7 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li...)
- 06:23, 8 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 August 2009
- 06:22, 8 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/6 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Cloning of p53 coding sequence</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>Isolate...)
- 23:35, 7 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/5 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Cloning of p53 coding sequence</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>Prepare ...)
- 23:34, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 August 2009
- 23:18, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 August 2009
- 09:22, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 09:15, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/11 July 2009
- 09:13, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 July 2009
- 09:10, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 July 2009
- 09:07, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 July 2009
- 09:00, 7 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/10 July 2009
- 12:53, 6 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 August 2009
- 13:53, 5 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 August 2009
- 12:18, 5 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/4 August 2009
- 12:04, 5 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 11:27, 5 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/3 August 2009
- 10:49, 5 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/3 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Cloning of p53 coding sequence</div></h3> <h4>Marcin</h4> <p>Task 1:</p> <ul> <li>Isolation pS...)
- 04:59, 3 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 August 2009
- 04:58, 3 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/2 August 2009
- 19:44, 2 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/2 August 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Cloning the p53 coding sequence</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>Prepare...)
- 18:36, 2 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/27 July 2009
- 18:18, 2 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/26 July 2009
- 18:18, 2 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/26 July 2009
- 18:17, 2 August 2009 (diff | hist) N Team:Warsaw/Calendar-Main/26 July 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>...)
- 18:17, 2 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009
- 18:13, 2 August 2009 (diff | hist) Team:Warsaw/Calendar-Main/25 July 2009
- 07:08, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 July 2009
- 06:52, 28 July 2009 (diff | hist) N File:P53 PCR 21 07 09.png (top)
- 06:49, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/21 July 2009
- 06:19, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 July 2009
- 06:12, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/20 July 2009
- 05:43, 28 July 2009 (diff | hist) m Team:Warsaw/Calendar-Main/17 July 2009
- 05:43, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/19 July 2009
- 05:38, 28 July 2009 (diff | hist) N File:B0032 digest 18 07 09.png (top)
- 04:55, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/18 July 2009
- 04:50, 28 July 2009 (diff | hist) N File:PKS-kontrola wstawki 18 07 09.png (top)
- 04:46, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 July 2009
- 04:44, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 July 2009
- 04:38, 28 July 2009 (diff | hist) N File:Biobricks gel-out evaluation 17 07 09.png (top)
- 04:32, 28 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 July 2009
- 04:12, 28 July 2009 (diff | hist) N File:Biobricks digest 16 07 09.png (top)
- 21:17, 27 July 2009 (diff | hist) N Team:Warsaw/Calendar-Main/25 July 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li...)
- 18:07, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 18:06, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 18:04, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 18:03, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 17:59, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 06:31, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 July 2009
- 06:13, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/23 July 2009
- 06:02, 27 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009
- 00:29, 23 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009
- 22:36, 22 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009
- 22:35, 22 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009
- 22:34, 22 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/22 July 2009
- 22:27, 22 July 2009 (diff | hist) N Team:Warsaw/Calendar-Main/22 July 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of invasion operon</div></h3> <h4>Marcin</h4> <br/> <p>Task 1:</p> <ul> <li>Prepare ch...)
- 00:09, 22 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/19 July 2009
- 00:08, 22 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/19 July 2009
- 00:07, 22 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/19 July 2009
- 23:51, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/18 July 2009
- 23:38, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/17 July 2009
- 05:58, 21 July 2009 (diff | hist) N Team:Warsaw/Calendar-Main/17 July 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> <html> <h3><div style="text-align: center;">Assembly of endosomal detection operon</div></h3> <h4>Marcin</h4> <p>Task 1:</p> <ul> <li>Ligat...)
- 05:46, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 05:45, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 05:31, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 05:31, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 00:21, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 00:19, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 00:18, 21 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/16 July 2009
- 08:38, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 08:33, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 08:13, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/9 July 2009
- 08:12, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/9 July 2009
- 08:11, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/9 July 2009
- 07:45, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/5 July 2009
- 05:45, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009
- 05:44, 19 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009
- 14:33, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/9 July 2009
- 13:56, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 July 2009
- 13:56, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 July 2009
- 13:54, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 July 2009
- 13:38, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/8 July 2009
- 13:17, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009
- 13:14, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009
- 11:00, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009
- 10:44, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009
- 10:09, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 May 2009
- 10:05, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/6 May 2009
- 09:26, 18 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/24 April 2009
- 13:51, 16 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009
- 13:50, 16 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009
- 13:39, 16 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009
- 13:30, 16 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/15 July 2009
- 13:22, 16 July 2009 (diff | hist) N File:Biobricks izolacja 15 07 09.png (top)
- 13:16, 16 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 13:11, 16 July 2009 (diff | hist) N File:P53 PCR after digest 13 07 09.png (top)
- 13:04, 16 July 2009 (diff | hist) N File:P53 control digest 13 07 09.png (top)
- 09:34, 16 July 2009 (diff | hist) N File:PCR reaction-p53 13 07 09.png (top)
- 09:33, 16 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 22:28, 15 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009
- 02:55, 15 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009
- 02:51, 15 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009
- 02:42, 15 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/14 July 2009
- 02:41, 15 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/13 July 2009
- 16:57, 14 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009
- 16:56, 14 July 2009 (diff | hist) Team:Warsaw/Calendar-Main/28 May 2009
- 16:35, 14 July 2009 (diff | hist) N Team:Warsaw/Calendar-Main/13 July 2009 (New page: {{WarNotebook}} <!-- do not edit above me! --> ===Cloning the p53 coding sequence=== '''Marcin''' Task 1: *Prepare PCR reaction to amplified p53 coding sequence. Methods: * DNA matrix ...)
(Latest | Earliest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)